Anti-AGGF1
Catalog Number:
ATA-HPA037644
| Article Name: |
Anti-AGGF1 |
| Biozol Catalog Number: |
ATA-HPA037644 |
| Supplier Catalog Number: |
HPA037644 |
| Alternative Catalog Number: |
ATA-HPA037644-100,ATA-HPA037644-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
FLJ10283, GPATC7, GPATCH7, HSU84971, VG5Q |
| Rabbit Polyclonal AGGF1 Antibody against Human angiogenic factor with G-patch and FHA domains 1. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 |
| NCBI: |
55109 |
| UniProt: |
Q8N302 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
VEELSKILQRGRNEDNKKSDVEVQTENHAPWSISDYFYQTYYNDVSLPNKVTELSDQQDQAIETSILNSKDHLQVENDAYPGTDRTENVKYRQVDHFASNSQEPA |
![]()
|
WB Image Caption 1 |
