Anti-LRCH4
Catalog Number:
ATA-HPA037668
- Images (8)
| Article Name: | Anti-LRCH4 |
| Biozol Catalog Number: | ATA-HPA037668 |
| Supplier Catalog Number: | HPA037668 |
| Alternative Catalog Number: | ATA-HPA037668-100,ATA-HPA037668-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | LRN, LRRN1 |
| leucine-rich repeats and calponin homology (CH) domain containing 4 |
| Anti-LRCH4 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 4034 |
| UniProt: | O75427 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ELSFRISELAREPRGPRERKEDGSADGDPVQIDFIDSHVPGEDEERGTVEEQRPPELSPGAGDRERAPSSRRE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LRCH4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human spleen and liver tissues using Anti-LRCH4 antibody. Corresponding LRCH4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human spleen shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA037668-100ul |
|
|
|
|
|
HPA037668-100ul |
|
|
HPA037668-100ul |
Product Guarantee and Expert Support
