Anti-FCHO2

Catalog Number: ATA-HPA037686
Article Name: Anti-FCHO2
Biozol Catalog Number: ATA-HPA037686
Supplier Catalog Number: HPA037686
Alternative Catalog Number: ATA-HPA037686-100,ATA-HPA037686-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FCHO2
FCH domain only 2
Anti-FCHO2
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 115548
UniProt: Q0JRZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KGTGKERPGLIEFEECDTASAVEGIKPRKRKTFALPGIIKKEKDAESVECPDADSLNIPDVDEEGYSI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FCHO2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemical staining of human colon, lymph node, placenta and testis using Anti-FCHO2 antibody HPA037686 (A) shows similar protein distribution across tissues to independent antibody HPA037685 (B).
Immunohistochemical staining of human placenta using Anti-FCHO2 antibody HPA037686.
Immunohistochemical staining of human colon using Anti-FCHO2 antibody HPA037686.
Immunohistochemical staining of human lymph node using Anti-FCHO2 antibody HPA037686.
Immunohistochemical staining of human testis using Anti-FCHO2 antibody HPA037686.
HPA037686-100ul
HPA037686-100ul
HPA037686-100ul