Anti-NUP155
Catalog Number:
ATA-HPA037775
- Images (9)
| Article Name: | Anti-NUP155 |
| Biozol Catalog Number: | ATA-HPA037775 |
| Supplier Catalog Number: | HPA037775 |
| Alternative Catalog Number: | ATA-HPA037775-100,ATA-HPA037775-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0791, N155 |
| nucleoporin 155kDa |
| Anti-NUP155 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 9631 |
| UniProt: | O75694 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TPSHGIQPPAMSTPVCALGNPATQATNMSCVTGPEIVYSGKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NUP155 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear membrane. |
|
|
Immunohistochemistry analysis in human testis and liver tissues using HPA037775 antibody. Corresponding NUP155 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate nuclear membrane positivity in neurons. |
|
|
Immunohistochemical staining of human skin shows weak to moderate nuclear membrane positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear membrane positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human liver shows very weak positivity in hepatocytes as expected. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and NUP155 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403513). |
|
|
HPA037775-100ul |
|
|
HPA037775-100ul |
Product Guarantee and Expert Support
