Anti-TIMM10B
Catalog Number:
ATA-HPA037809
| Article Name: |
Anti-TIMM10B |
| Biozol Catalog Number: |
ATA-HPA037809 |
| Supplier Catalog Number: |
HPA037809 |
| Alternative Catalog Number: |
ATA-HPA037809-100,ATA-HPA037809-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
FXC1, TIM10B, Tim9b |
| Rabbit Polyclonal TIMM10B Antibody against Human translocase of inner mitochondrial membrane 10B. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.2 |
| NCBI: |
26515 |
| UniProt: |
Q9Y5J6 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
QQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS |
![]()
|
WB Image Caption 1 |
