Anti-ARMC4
Catalog Number:
ATA-HPA037829
- Images (7)
| Article Name: | Anti-ARMC4 |
| Biozol Catalog Number: | ATA-HPA037829 |
| Supplier Catalog Number: | HPA037829 |
| Alternative Catalog Number: | ATA-HPA037829-100,ATA-HPA037829-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CILD23, DKFZP434P1735, FLJ10376, FLJ10817 |
| armadillo repeat containing 4 |
| Anti-ARMC4 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 55130 |
| UniProt: | Q5T2S8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FSEDQQKEKDQLGKAPKKEEAAALRKDISGSDKRSLEKNQINFWRNQMTKRWEPSLNWKTTVNYKGKGSAKEIQEDKHTGKLEKPRPSVSHG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ARMC4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human fallopian tube and placenta tissues using Anti-ARMC4 antibody. Corresponding ARMC4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Immunohistochemical staining of human placenta shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
|
HPA037829-100ul |
|
|
HPA037829-100ul |
|
|
HPA037829-100ul |
Product Guarantee and Expert Support
