Anti-HORMAD1
Catalog Number:
ATA-HPA037850
- Images (8)
| Article Name: | Anti-HORMAD1 |
| Biozol Catalog Number: | ATA-HPA037850 |
| Supplier Catalog Number: | HPA037850 |
| Alternative Catalog Number: | ATA-HPA037850-100,ATA-HPA037850-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CT46, DKFZP434A1315 |
| HORMA domain containing 1 |
| Anti-HORMAD1 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 84072 |
| UniProt: | Q86X24 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MSESKTRSGKVFQNKMANGNQPVKSSKENRKRSQHESGRIVLHHFDSSSQESVPKRRKFSEPK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HORMAD1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human testis and cerebral cortex tissues using HPA037850 antibody. Corresponding HORMAD1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human skin shows cytoplasmic positivity in a subset of squamous epithelial cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts. |
|
|
HPA037850-100ul |
|
|
HPA037850-100ul |
|
|
HPA037850-100ul |
Product Guarantee and Expert Support
