Anti-WAPL
Catalog Number:
ATA-HPA037874
- Images (8)
| Article Name: | Anti-WAPL |
| Biozol Catalog Number: | ATA-HPA037874 |
| Supplier Catalog Number: | HPA037874 |
| Alternative Catalog Number: | ATA-HPA037874-100,ATA-HPA037874-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FOE, KIAA0261, WAPAL |
| WAPL cohesin release factor |
| Anti-WAPL |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 23063 |
| UniProt: | Q7Z5K2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | IVTALKCRREDKELYTVVQHVKHFNDVVEFGENQEFTDDIEYLLSGLKSTQPLNTRCLSVISLATKCAMPSFRMHLR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | WAPL |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human colon, lymph node, skin and testis using Anti-WAPL antibody HPA037874 (A) shows similar protein distribution across tissues to independent antibody HPA037875 (B). |
|
|
Immunohistochemical staining of human skin using Anti-WAPL antibody HPA037874. |
|
|
Immunohistochemical staining of human testis using Anti-WAPL antibody HPA037874. |
|
|
Immunohistochemical staining of human lymph node using Anti-WAPL antibody HPA037874. |
|
|
Immunohistochemical staining of human colon using Anti-WAPL antibody HPA037874. |
|
|
HPA037874-100ul |
|
|
HPA037874-100ul |
|
|
HPA037874-100ul |
Product Guarantee and Expert Support
