Anti-FAM170A ChIP certified

Catalog Number: ATA-HPA037902
Article Name: Anti-FAM170A ChIP certified
Biozol Catalog Number: ATA-HPA037902
Supplier Catalog Number: HPA037902
Alternative Catalog Number: ATA-HPA037902-100,ATA-HPA037902-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FAM170A
family with sequence similarity 170, member A
Anti-FAM170A
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Isotype: IgG
NCBI: 340069
UniProt: A1A519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KRRQKRKHLENEESQETAEKGGGMSKSQEDALQPGSTRVAKGWSQGVGEVTSTSEYCSCVSSSRKLIHSGIQRIHRDSPQPQSPLAQVQERGETPPRS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FAM170A
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-FAM170A antibody. Corresponding FAM170A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human endometrium shows low expression as expected.
Immunohistochemical staining of human testis shows high expression.
Western blot analysis in control (vector only transfected HEK293T lysate) and FAM170A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY405332).
HPA037902-100ul
HPA037902-100ul
HPA037902-100ul