Anti-PRDX5
Catalog Number:
ATA-HPA037916
- Images (8)
| Article Name: | Anti-PRDX5 |
| Biozol Catalog Number: | ATA-HPA037916 |
| Supplier Catalog Number: | HPA037916 |
| Alternative Catalog Number: | ATA-HPA037916-100,ATA-HPA037916-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ACR1, AOEB166, B166, MGC117264, MGC142283, MGC142285, PLP, PMP20, PRDX6, PRXV, SBBI10 |
| peroxiredoxin 5 |
| Anti-PRDX5 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 25824 |
| UniProt: | P30044 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PRDX5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-PRDX5 antibody. Corresponding PRDX5 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Western blot analysis using Anti-PRDX5 antibody HPA037916 (A) shows similar pattern to independent antibody HPA037915 (B). |
|
|
HPA037916-100ul |
|
|
|
|
|
HPA037916-100ul |
|
|
HPA037916-100ul |
Product Guarantee and Expert Support
