Anti-SHTN1
Catalog Number:
ATA-HPA037942
- Images (8)
| Article Name: | Anti-SHTN1 |
| Biozol Catalog Number: | ATA-HPA037942 |
| Supplier Catalog Number: | HPA037942 |
| Alternative Catalog Number: | ATA-HPA037942-100,ATA-HPA037942-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA1598, shootin-1, shootin1 |
| shootin 1 |
| Anti-SHTN1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 57698 |
| UniProt: | A0MZ66 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NRVSMLAVEEYEEMQVNLELEKDLRKKAESFAQEMFIEQNKLKRQSHLLLQSSIPDQQLLKALDENAKLTQQLEEERIQHQQK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SHTN1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-SHTN1 antibody. Corresponding SHTN1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Western blot analysis using Anti-SHTN1 antibody HPA037942 (A) shows similar pattern to independent antibody HPA037943 (B). |
|
|
HPA037942-100ul |
|
|
|
|
|
HPA037942-100ul |
|
|
HPA037942-100ul |
Product Guarantee and Expert Support
