Anti-OLAH
Catalog Number:
ATA-HPA037948
- Images (8)
| Article Name: | Anti-OLAH |
| Biozol Catalog Number: | ATA-HPA037948 |
| Supplier Catalog Number: | HPA037948 |
| Alternative Catalog Number: | ATA-HPA037948-100,ATA-HPA037948-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ11106, SAST, THEDC1 |
| oleoyl-ACP hydrolase |
| Anti-OLAH |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 55301 |
| UniProt: | Q9NV23 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | OLAH |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and stomach tissues using Anti-OLAH antibody. Corresponding OLAH RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human stomach shows low expression as expected. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and OLAH over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400421). |
|
|
HPA037948-100ul |
|
|
|
|
|
HPA037948-100ul |
|
|
HPA037948-100ul |
Product Guarantee and Expert Support
