Anti-ARFIP2

Catalog Number: ATA-HPA038157
Article Name: Anti-ARFIP2
Biozol Catalog Number: ATA-HPA038157
Supplier Catalog Number: HPA038157
Alternative Catalog Number: ATA-HPA038157-100,ATA-HPA038157-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: POR1
Clonality: Polyclonal
Concentration: 0,05
NCBI: 23647
UniProt: P53365
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GSGDGLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSRT
Target: ARFIP2
HPA038157-100ul