Anti-HPD
Catalog Number:
ATA-HPA038322
- Images (9)
| Article Name: | Anti-HPD |
| Biozol Catalog Number: | ATA-HPA038322 |
| Supplier Catalog Number: | HPA038322 |
| Alternative Catalog Number: | ATA-HPA038322-100,ATA-HPA038322-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | 4-HPPD, 4HPPD, GLOD3, PPD |
| 4-hydroxyphenylpyruvate dioxygenase |
| Anti-HPD |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 3242 |
| UniProt: | P32754 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | REPWVEQDKFGKVKFAVLQTYGDTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEMIDHIVGNQP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HPD |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human liver and duodenum tissues using Anti-HPD antibody. Corresponding HPD RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human duodenum shows low expression as expected. |
|
|
Immunohistochemical staining of human liver shows high expression. |
|
|
Western blot analysis using Anti-HPD antibody HPA038322 (A) shows similar pattern to independent antibody HPA038321 (B). |
|
|
Western blot analysis in mouse liver tissue and rat liver tissue. |
|
|
HPA038322-100ul |
|
|
|
|
|
HPA038322-100ul |
|
|
HPA038322-100ul |
Product Guarantee and Expert Support
