Anti-ZNF302

Catalog Number: ATA-HPA038377
Article Name: Anti-ZNF302
Biozol Catalog Number: ATA-HPA038377
Supplier Catalog Number: HPA038377
Alternative Catalog Number: ATA-HPA038377-100,ATA-HPA038377-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ZNF135L, ZNF140L, ZNF327
Clonality: Polyclonal
Concentration: 0,05
NCBI: 55900
UniProt: Q9NR11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KAYPFPLSHSVPASVNFGFSALFEHCSEVTEIFELSELCVFWVLHFLSNSPNSTVEA
Target: ZNF302
HPA038377-100ul