Anti-ADK

Catalog Number: ATA-HPA038409
Article Name: Anti-ADK
Biozol Catalog Number: ATA-HPA038409
Supplier Catalog Number: HPA038409
Alternative Catalog Number: ATA-HPA038409-100,ATA-HPA038409-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AK
adenosine kinase
Anti-ADK
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 132
UniProt: P55263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ADK
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human lymph node shows strong nuclear positivity in non-germinal center cells.
Western blot analysis in human cell lines PC-3 and A-549 using Anti-ADK antibody. Corresponding ADK RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western blot analysis in human cell line A-431.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA038409-100ul
HPA038409-100ul
HPA038409-100ul