Anti-PPP6R3
Catalog Number:
ATA-HPA038467
- Images (8)
| Article Name: | Anti-PPP6R3 |
| Biozol Catalog Number: | ATA-HPA038467 |
| Supplier Catalog Number: | HPA038467 |
| Alternative Catalog Number: | ATA-HPA038467-100,ATA-HPA038467-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C11orf23, DKFZp781E17107, DKFZp781E2374, DKFZp781O2362, FLJ11058, FLJ43065, KIAA1558, MGC125711, MGC125712, PP6R3, SAP190, SAPL, SAPLa, SAPS3 |
| protein phosphatase 6, regulatory subunit 3 |
| Anti-PPP6R3 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 55291 |
| UniProt: | Q5H9R7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | DGAKQDLFEPSSANTEDKMEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTKETGWASFSEFTSSLSTKDSLRSNSPVEMETSTEP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PPP6R3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm, plasma membrane & cytosol. |
|
|
Immunohistochemistry analysis in human parathyroid gland and pancreas tissues using Anti-PPP6R3 antibody. Corresponding PPP6R3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human parathyroid gland shows high expression. |
|
|
HPA038467-100ul |
|
|
|
|
|
HPA038467-100ul |
|
|
HPA038467-100ul |
Product Guarantee and Expert Support
