Anti-OTUD1
Catalog Number:
ATA-HPA038504
- Images (7)
| Article Name: | Anti-OTUD1 |
| Biozol Catalog Number: | ATA-HPA038504 |
| Supplier Catalog Number: | HPA038504 |
| Alternative Catalog Number: | ATA-HPA038504-100,ATA-HPA038504-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DUBA7, OTDC1 |
| OTU deubiquitinase 1 |
| Anti-OTUD1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 220213 |
| UniProt: | Q5VV17 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SSAAEPVIVSRSDPRDEKLALYLAEVEKQDKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADHLDHFSPLIEGDVGEFIIAAAQD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | OTUD1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human duodenum shows moderate to strong cytoplasmic positivity in lymphoid cells. |
|
|
HPA038504-100ul |
|
|
HPA038504-100ul |
|
|
HPA038504-100ul |
Product Guarantee and Expert Support
