Anti-NEDD1
Catalog Number:
ATA-HPA038591
- Images (9)
| Article Name: | Anti-NEDD1 |
| Biozol Catalog Number: | ATA-HPA038591 |
| Supplier Catalog Number: | HPA038591 |
| Alternative Catalog Number: | ATA-HPA038591-100,ATA-HPA038591-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GCP-WD, TUBGCP7 |
| neural precursor cell expressed, developmentally down-regulated 1 |
| Anti-NEDD1 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 121441 |
| UniProt: | Q8NHV4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SSTPNPKIASSVTAGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEGL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NEDD1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Western blot analysis in human cell lines PC-3 and HeLa using Anti-NEDD1 antibody. Corresponding NEDD1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
HPA038591-100ul |
|
|
|
|
|
HPA038591-100ul |
|
|
HPA038591-100ul |
Product Guarantee and Expert Support
