Anti-UBASH3B

Catalog Number: ATA-HPA038606
Article Name: Anti-UBASH3B
Biozol Catalog Number: ATA-HPA038606
Supplier Catalog Number: HPA038606
Alternative Catalog Number: ATA-HPA038606-100,ATA-HPA038606-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1959, STS-1, TULA-2, TULA2
Clonality: Polyclonal
Concentration: 0,05
NCBI: 84959
UniProt: Q8TF42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YGTSLTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGETTPLTIICQPM
Target: UBASH3B
HPA038606-100ul