Anti-MID1IP1
Catalog Number:
ATA-HPA038816
- Images (7)
| Article Name: | Anti-MID1IP1 |
| Biozol Catalog Number: | ATA-HPA038816 |
| Supplier Catalog Number: | HPA038816 |
| Alternative Catalog Number: | ATA-HPA038816-100,ATA-HPA038816-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ10386, G12-like, MIG12, STRAIT11499, THRSPL |
| MID1 interacting protein 1 |
| Anti-MID1IP1 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 58526 |
| UniProt: | Q9NPA3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | CLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MID1IP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human tonsil shows no cytoplasmic positivity as expected. |
|
|
HPA038816-100ul |
|
|
HPA038816-100ul |
|
|
HPA038816-100ul |
Product Guarantee and Expert Support
