Anti-A2ML1

Product Overview

• Article Name: Anti-A2ML1
• Biozol Catalog Number: ATA-HPA038847
• Supplier Catalog Number: HPA038847
• Alternative Catalog Number: ATA-HPA038847-100,ATA-HPA038847-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CPAMD9, FLJ25179

Product Description

alpha-2-macroglobulin-like 1

Additional Information

Anti-A2ML1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 144568
• UniProt: A8K2U0
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: MTFEDTSNFYHPNFPFSGKIRVRGHDDSFLKNHLVFLVIYGTNGTFNQTLVTDNNGLAPFTLETSGWNGTDVSLEGKFQMEDLVYNPEQVPRYYQ
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: A2ML1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human esophagus and liver tissues using HPA038847 antibody. Corresponding A2ML1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human esophagus, liver, skin and tonsil using Anti-A2ML1 antibody HPA038847 (A) shows similar protein distribution across tissues to independent antibody HPA038848 (B).

Immunohistochemical staining of human esophagus shows strong cytoplasmic/membranous positivity in squamous epithelial cells.

Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemical staining of human skin shows strong cytoplasmic positivity in epidermal cells.

Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in squamous epithelial cells.

HPA038847-100ul

HPA038847-100ul

HPA038847-100ul