Anti-C11orf80

Catalog Number: ATA-HPA038933
Article Name: Anti-C11orf80
Biozol Catalog Number: ATA-HPA038933
Supplier Catalog Number: HPA038933
Alternative Catalog Number: ATA-HPA038933-100,ATA-HPA038933-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ22531
chromosome 11 open reading frame 80
Anti-C11orf80
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 79703
UniProt: Q8N6T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SYSQDMTGVTPFQMIFEVDEKPRTLMTDCLVIKHFLRKIIMVHPKVRFHFSVKVNGILSTEIFGVENEPTLNLGNGIALLVDSQHYVSRPNFGTIESHC
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: C11orf80
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
Immunohistochemical staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
HPA038933-100ul
HPA038933-100ul
HPA038933-100ul