Anti-CD27
Catalog Number:
ATA-HPA038936
- Images (8)
| Article Name: | Anti-CD27 |
| Biozol Catalog Number: | ATA-HPA038936 |
| Supplier Catalog Number: | HPA038936 |
| Alternative Catalog Number: | ATA-HPA038936-100,ATA-HPA038936-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | S152, TNFRSF7, Tp55 |
| CD27 molecule |
| Anti-CD27 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 939 |
| UniProt: | P26842 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD27 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human tonsil and cerebral cortex tissues using Anti-CD27 antibody. Corresponding CD27 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human tonsil shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line Daudi |
|
|
HPA038936-100ul |
|
|
|
|
|
HPA038936-100ul |
|
|
HPA038936-100ul |
Product Guarantee and Expert Support
