Anti-WBP4

Catalog Number: ATA-HPA038965
Article Name: Anti-WBP4
Biozol Catalog Number: ATA-HPA038965
Supplier Catalog Number: HPA038965
Alternative Catalog Number: ATA-HPA038965-100,ATA-HPA038965-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FBP21, MGC117310
WW domain binding protein 4
Anti-WBP4
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 11193
UniProt: O75554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: WBP4
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human stomach shows strong nuclear positivity in glandular cells.
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA038965-100ul
HPA038965-100ul
HPA038965-100ul