Anti-MAP6

Catalog Number: ATA-HPA039061
Article Name: Anti-MAP6
Biozol Catalog Number: ATA-HPA039061
Supplier Catalog Number: HPA039061
Alternative Catalog Number: ATA-HPA039061-100,ATA-HPA039061-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ41346, KIAA1878, STOP
microtubule-associated protein 6
Anti-MAP6
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 4135
UniProt: Q96JE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TSASHKPTRKAKDKQAVSGQAAKKKSAEGPSTTKPDDKEQSKEMNNKLAEAKESLAQPVSDSSKTQGPVATEPDKDQGSVVPGLLKGQGPMVQEPLKKQGSVVPGPPKDLGPM
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MAP6
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-MAP6 antibody. Corresponding MAP6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA039061-100ul
HPA039061-100ul
HPA039061-100ul