Anti-TMEM39A
Catalog Number:
ATA-HPA039140
- Images (8)
| Article Name: | Anti-TMEM39A |
| Biozol Catalog Number: | ATA-HPA039140 |
| Supplier Catalog Number: | HPA039140 |
| Alternative Catalog Number: | ATA-HPA039140-100,ATA-HPA039140-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ10902 |
| transmembrane protein 39A |
| Anti-TMEM39A |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 55254 |
| UniProt: | Q9NV64 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HQDSRAHLLLTDYNYVVQHEAVEESASTVGGLAKSKDFLSLLLESLKEQFNNATPIPTHSCPLSPDLIRNEVECLKADFNHRIK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TMEM39A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human rectum shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
HPA039140-100ul |
|
|
|
|
|
HPA039140-100ul |
|
|
HPA039140-100ul |
Product Guarantee and Expert Support
