Anti-DQX1

Catalog Number: ATA-HPA039158
Article Name: Anti-DQX1
Biozol Catalog Number: ATA-HPA039158
Supplier Catalog Number: HPA039158
Alternative Catalog Number: ATA-HPA039158-100,ATA-HPA039158-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ23757
DEAQ box RNA-dependent ATPase 1
Anti-DQX1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Isotype: IgG
NCBI: 165545
UniProt: Q8TE96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LQGLLQDARLEKLPGDLRVVVVTDPALEPKLRAFWGNPPIVHIPREPGERPSPIYWDTIPPDRVEAACQAVLELCRKELPGDVLVFLPSEEEISLCCE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DQX1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry analysis in human duodenum and liver tissues using Anti-DQX1 antibody. Corresponding DQX1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human duodenum shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA039158-100ul
HPA039158-100ul
HPA039158-100ul