Anti-TRIM7

Catalog Number: ATA-HPA039213
Article Name: Anti-TRIM7
Biozol Catalog Number: ATA-HPA039213
Supplier Catalog Number: HPA039213
Alternative Catalog Number: ATA-HPA039213-100,ATA-HPA039213-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GNIP, RNF90
tripartite motif containing 7
Anti-TRIM7
Clonality: Polyclonal
Concentration: 0.8 mg/ml
Isotype: IgG
NCBI: 81786
UniProt: Q9C029
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LRVLKKELEDCEVFRSTEKKESKELLKQMAAEQEKVGAEFQALRAFLVEQEGRLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TRIM7
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & vesicles.
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HPA039213-100ul
HPA039213-100ul
HPA039213-100ul