Anti-PRPH
Catalog Number:
ATA-HPA039277
- Images (8)
| Article Name: | Anti-PRPH |
| Biozol Catalog Number: | ATA-HPA039277 |
| Supplier Catalog Number: | HPA039277 |
| Alternative Catalog Number: | ATA-HPA039277-100,ATA-HPA039277-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | NEF4, PRPH1 |
| peripherin |
| Anti-PRPH |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 5630 |
| UniProt: | P41219 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSASPSSSVRLGSFRSPRAGAGALLRLPSERLDFSMAEALNQEFLATRSNEKQEL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PRPH |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, liver and rectum using Anti-PRPH antibody HPA039277 (A) shows similar protein distribution across tissues to independent antibody HPA063887 (B). |
|
|
Immunohistochemical staining of human liver using Anti-PRPH antibody HPA039277. |
|
|
Immunohistochemical staining of human rectum using Anti-PRPH antibody HPA039277. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-PRPH antibody HPA039277. |
|
|
Immunohistochemical staining of human colon using Anti-PRPH antibody HPA039277. |
|
|
HPA039277-100ul |
|
|
HPA039277-100ul |
|
|
HPA039277-100ul |
Product Guarantee and Expert Support
