Anti-RNF214

Catalog Number: ATA-HPA039332
Article Name: Anti-RNF214
Biozol Catalog Number: ATA-HPA039332
Supplier Catalog Number: HPA039332
Alternative Catalog Number: ATA-HPA039332-100,ATA-HPA039332-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp547C195
ring finger protein 214
Anti-RNF214
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 257160
UniProt: Q8ND24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VTRSLKAGCHTKQLASRNCSEEKSPQTSILKEGNRDTSLDFRPVVSPANGVEGVRVDQDDDQDSSSLKLSQNIAVQTDFKTADSEVNTDQDIEKNLD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RNF214
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus.
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA039332-100ul
HPA039332
HPA039332
HPA039332-100ul
HPA039332-100ul