Anti-PPTC7
Catalog Number:
ATA-HPA039335
- Images (9)
| Article Name: | Anti-PPTC7 |
| Biozol Catalog Number: | ATA-HPA039335 |
| Supplier Catalog Number: | HPA039335 |
| Alternative Catalog Number: | ATA-HPA039335-100,ATA-HPA039335-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | TA-PP2C |
| PTC7 protein phosphatase homolog (S. cerevisiae) |
| Anti-PPTC7 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 160760 |
| UniProt: | Q8NI37 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ILTTSYCELLQNKVPLLGSSTACIVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PPTC7 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis using Anti-PPTC7 antibody HPA039335 (A) shows similar pattern to independent antibody HPA040614 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA039335-100ul |
|
|
|
|
|
|
|
|
HPA039335-100ul |
|
|
HPA039335-100ul |
Product Guarantee and Expert Support
