Anti-PPTC7

Catalog Number: ATA-HPA039335
Article Name: Anti-PPTC7
Biozol Catalog Number: ATA-HPA039335
Supplier Catalog Number: HPA039335
Alternative Catalog Number: ATA-HPA039335-100,ATA-HPA039335-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TA-PP2C
PTC7 protein phosphatase homolog (S. cerevisiae)
Anti-PPTC7
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 160760
UniProt: Q8NI37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ILTTSYCELLQNKVPLLGSSTACIVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PPTC7
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Western blot analysis using Anti-PPTC7 antibody HPA039335 (A) shows similar pattern to independent antibody HPA040614 (B).
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA039335-100ul
HPA039335-100ul
HPA039335-100ul