Anti-OSGEP

Catalog Number: ATA-HPA039449
Article Name: Anti-OSGEP
Biozol Catalog Number: ATA-HPA039449
Supplier Catalog Number: HPA039449
Alternative Catalog Number: ATA-HPA039449-100,ATA-HPA039449-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GCPL1, KAE1, OSGEP1, PRSMG1, TCS3
Clonality: Polyclonal
Concentration: 0,05
NCBI: 55644
UniProt: Q9NPF4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YVSGGNTQVIAYSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMD
Target: OSGEP
HPA039449-100ul