Anti-ZAR1L

Catalog Number: ATA-HPA039540
Article Name: Anti-ZAR1L
Biozol Catalog Number: ATA-HPA039540
Supplier Catalog Number: HPA039540
Alternative Catalog Number: ATA-HPA039540-100,ATA-HPA039540-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Z3CXXC7
Clonality: Polyclonal
Concentration: 0,3
NCBI: 646799
UniProt: A6NP61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FVRVPYGLYQGYGSTVPLGQPGLSGHKQPDWRQNMGPPTFLARPGLLVPANAPDYCIDPYKRAQLKAILSQMNPSLSPRLCKPNTK
Target: ZAR1L
HPA039540-100ul