Anti-NOP14

Catalog Number: ATA-HPA039596
Article Name: Anti-NOP14
Biozol Catalog Number: ATA-HPA039596
Supplier Catalog Number: HPA039596
Alternative Catalog Number: ATA-HPA039596-100,ATA-HPA039596-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C4orf9, NOL14, RES4-25, UTP2
NOP14 nucleolar protein
Anti-NOP14
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 8602
UniProt: P78316
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: REKPKSRKELIEELIAKSKQEKRERQAQREDALELTEKLDQDWKEIQTLLSHKTPKSENRDKKEKPKPDAYDMMVRELGFEMKAQPSNRMKT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NOP14
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemical staining of human hippocampus shows moderate nucleolar positivity in neurons.
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NOP14 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA039596-100ul
HPA039596-100ul
HPA039596-100ul