Anti-TCTN1
Catalog Number:
ATA-HPA039687
- Images (7)
| Article Name: | Anti-TCTN1 |
| Biozol Catalog Number: | ATA-HPA039687 |
| Supplier Catalog Number: | HPA039687 |
| Alternative Catalog Number: | ATA-HPA039687-100,ATA-HPA039687-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ21127, JBTS13, TECT1 |
| tectonic family member 1 |
| Anti-TCTN1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 79600 |
| UniProt: | Q2MV58 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VPLSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQDCLALEGVRTPVLFGYTMQSGCKLRLTGALPCQLVAQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TCTN1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected. |
|
|
HPA039687-100ul |
|
|
HPA039687-100ul |
|
|
HPA039687-100ul |
Product Guarantee and Expert Support
