Anti-RPUSD4
Catalog Number:
ATA-HPA039689
- Images (8)
| Article Name: | Anti-RPUSD4 |
| Biozol Catalog Number: | ATA-HPA039689 |
| Supplier Catalog Number: | HPA039689 |
| Alternative Catalog Number: | ATA-HPA039689-100,ATA-HPA039689-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ14494 |
| RNA pseudouridylate synthase domain containing 4 |
| Anti-RPUSD4 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 84881 |
| UniProt: | Q96CM3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NLVVINKPYGLPVHGGPGVQLCITDVLPILAKMLHGHKAEPLHLCHRLDKETTGVMVLAWDKDMAHQVQELFRTRQVVKKYWAITVHVP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RPUSD4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human skin shows strong nuclear positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows strong nuclear positivity in myocytes. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and RPUSD4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409829). |
|
|
HPA039689-100ul |
|
|
HPA039689-100ul |
|
|
HPA039689-100ul |
Product Guarantee and Expert Support
