Anti-WHAMM
Catalog Number:
ATA-HPA039690
- Images (8)
| Article Name: | Anti-WHAMM |
| Biozol Catalog Number: | ATA-HPA039690 |
| Supplier Catalog Number: | HPA039690 |
| Alternative Catalog Number: | ATA-HPA039690-100,ATA-HPA039690-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA1971, WHDC1 |
| WAS protein homolog associated with actin, golgi membranes and microtubules |
| Anti-WHAMM |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 123720 |
| UniProt: | Q8TF30 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RALSSSSQAATHQNLGFRAPVKDDQPRPLVCESPAERPRDSLESFSCPGSMDEVLASLRHGRAPLRKVEVPAVRPPHASINEHILAAIR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | WHAMM |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to cytosol. |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human endometrium shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in non - germinal center cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
|
|
|
|
|
|
HPA039690-100ul |
Product Guarantee and Expert Support
