Anti-AP3B2

Catalog Number: ATA-HPA039818
Article Name: Anti-AP3B2
Biozol Catalog Number: ATA-HPA039818
Supplier Catalog Number: HPA039818
Alternative Catalog Number: ATA-HPA039818-100,ATA-HPA039818-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NAPTB
adaptor-related protein complex 3, beta 2 subunit
Anti-AP3B2
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 8120
UniProt: Q13367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VPEWTKCSNREKRKEKEKPFYSDSEGESGPTESADSDPESESESDSKSSSESGSGESSSESDNEDQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: AP3B2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-AP3B2 antibody. Corresponding AP3B2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and AP3B2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401473).
HPA039818-100ul
HPA039818-100ul
HPA039818-100ul