Anti-GPR176
Catalog Number:
ATA-HPA039943
- Images (7)
| Article Name: | Anti-GPR176 |
| Biozol Catalog Number: | ATA-HPA039943 |
| Supplier Catalog Number: | HPA039943 |
| Alternative Catalog Number: | ATA-HPA039943-100,ATA-HPA039943-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Gm1012 |
| G protein-coupled receptor 176 |
Anti-GPR176 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 11245 |
| UniProt: | Q14439 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KCLIGTLVQLHHRYSRRNVVSTGSGMAEASLEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFSTCLEGEQGPQFA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GPR176 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell lines A-431 and MCF-7 using Anti-GPR176 antibody. Corresponding GPR176 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue |
|
|
HPA039943-100ul |
|
|
|
|
|
HPA039943-100ul |
|
|
HPA039943-100ul |
Product Guarantee and Expert Support
