Anti-TIMM10
Catalog Number:
ATA-HPA039946
- Images (9)
| Article Name: | Anti-TIMM10 |
| Biozol Catalog Number: | ATA-HPA039946 |
| Supplier Catalog Number: | HPA039946 |
| Alternative Catalog Number: | ATA-HPA039946-100,ATA-HPA039946-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | TIM10, TIM10A |
| translocase of inner mitochondrial membrane 10 homolog (yeast) |
| Anti-TIMM10 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 26519 |
| UniProt: | P62072 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TIMM10 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. |
|
|
Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human testis shows strong granular cytoplasmic positivity. |
|
|
Immunohistochemical staining of human liver shows moderate to strong granular cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human heart muscle shows strong granular cytoplasmic positivity. |
|
|
HPA039946-100ul |
|
|
|
|
|
HPA039946-100ul |
|
|
HPA039946-100ul |
Product Guarantee and Expert Support
