Anti-DDX55
Catalog Number:
ATA-HPA039962
| Article Name: |
Anti-DDX55 |
| Biozol Catalog Number: |
ATA-HPA039962 |
| Supplier Catalog Number: |
HPA039962 |
| Alternative Catalog Number: |
ATA-HPA039962-100,ATA-HPA039962-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
ICC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
KIAA1595 |
| DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 |
| Clonality: |
Polyclonal |
| Concentration: |
0.3 mg/ml |
| Isotype: |
IgG |
| NCBI: |
57696 |
| UniProt: |
Q8NHQ9 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
FALLRMPKMPELRGKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIKNKAWSKQKAK |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
DDX55 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
ICC-IF: 0.25-2 µg/ml |
![]()
|
Immunofluorescent staining of human cell line HeLa shows localization to nucleus & nucleoli. |
![]()
|
HPA039962-100ul |
