Anti-RIC8B

Catalog Number: ATA-HPA039970
Article Name: Anti-RIC8B
Biozol Catalog Number: ATA-HPA039970
Supplier Catalog Number: HPA039970
Alternative Catalog Number: ATA-HPA039970-100,ATA-HPA039970-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ10620, hSyn, RIC8
Clonality: Polyclonal
Isotype: IgG
NCBI: 55188
UniProt: Q9NVN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSL
Target: RIC8B
Antibody Type: Monoclonal Antibody
HPA039970-100ul