Anti-HMMR

Catalog Number: ATA-HPA040025
Article Name: Anti-HMMR
Biozol Catalog Number: ATA-HPA040025
Supplier Catalog Number: HPA040025
Alternative Catalog Number: ATA-HPA040025-100,ATA-HPA040025-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CD168, RHAMM
hyaluronan-mediated motility receptor (RHAMM)
Anti-HMMR
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Isotype: IgG
NCBI: 3161
UniProt: O75330
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SSAAHTQATLLLQEKYDSMVQSLEDVTAQFESYKALTASEIEDLKLENSSLQEKVAKAGKNAEDVQHQILATESSNQEYVRMLLDLQTKSALKET
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: HMMR
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and prostate tissues using Anti-HMMR antibody. Corresponding HMMR RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
HPA040025-100ul
HPA040025-100ul
HPA040025-100ul