Anti-METTL4

Catalog Number: ATA-HPA040061
Article Name: Anti-METTL4
Biozol Catalog Number: ATA-HPA040061
Supplier Catalog Number: HPA040061
Alternative Catalog Number: ATA-HPA040061-100,ATA-HPA040061-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ23017, HsT661
methyltransferase like 4
Anti-METTL4
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 64863
UniProt: Q8N3J2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: METTL4
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Western blot analysis in human tonsil tissue.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
HPA040061-100ul
HPA040061-100ul
HPA040061-100ul