Anti-NOP2
Catalog Number:
ATA-HPA040119
- Images (9)
| Article Name: | Anti-NOP2 |
| Biozol Catalog Number: | ATA-HPA040119 |
| Supplier Catalog Number: | HPA040119 |
| Alternative Catalog Number: | ATA-HPA040119-100,ATA-HPA040119-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | NOL1, NOP120, NSUN1, p120 |
| NOP2 nucleolar protein |
| Anti-NOP2 |
| Clonality: | Polyclonal |
| Concentration: | 1.0 mg/ml |
| Isotype: | IgG |
| NCBI: | 4839 |
| UniProt: | P46087 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NOP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoli. |
|
|
Immunohistochemical staining of human skin shows distinct nucleolar positivity in keratinocytes. |
|
|
Western blot analysis in human cell line NTERA-2. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
|
|
|
HPA040119-100ul |
|
|
|
|
|
HPA040119-100ul |
|
|
HPA040119-100ul |
Product Guarantee and Expert Support
