Anti-NOP2
Catalog Number:
ATA-HPA040119
| Article Name: |
Anti-NOP2 |
| Biozol Catalog Number: |
ATA-HPA040119 |
| Supplier Catalog Number: |
HPA040119 |
| Alternative Catalog Number: |
ATA-HPA040119-100,ATA-HPA040119-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ICC, IHC, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
NOL1, NOP120, NSUN1, p120 |
| Clonality: |
Polyclonal |
| Concentration: |
1.0 mg/ml |
| Isotype: |
IgG |
| NCBI: |
4839 |
| UniProt: |
P46087 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
KLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGH |
| Storage: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: |
NOP2 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoli. |
|
Immunohistochemical staining of human skin shows distinct nucleolar positivity in keratinocytes. |
|
Western blot analysis in human cell line NTERA-2. |
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
|
HPA040119-100ul |
|
|
|
HPA040119-100ul |
|
HPA040119-100ul |