Anti-DNAI7

Catalog Number: ATA-HPA040141
Article Name: Anti-DNAI7
Biozol Catalog Number: ATA-HPA040141
Supplier Catalog Number: HPA040141
Alternative Catalog Number: ATA-HPA040141-100,ATA-HPA040141-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CASC1, CFAP94, FLJ10921, LAS1, PPP1R54
Clonality: Polyclonal
Concentration: 0,1
NCBI: 55259
UniProt: Q6TDU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NIIQYQESILQLQELLHLKFGVATEILLKQASTLADLDSGNMEKVIKDENVTLYVWANLKKNPRHRSVRFSETQIGFEIPRILAT
Target: DNAI7
HPA040141-100ul