Anti-MYBPC3
Catalog Number:
ATA-HPA040147
- Images (9)
| Article Name: | Anti-MYBPC3 |
| Biozol Catalog Number: | ATA-HPA040147 |
| Supplier Catalog Number: | HPA040147 |
| Alternative Catalog Number: | ATA-HPA040147-100,ATA-HPA040147-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CMH4, FHC, MYBP-C |
| myosin binding protein C, cardiac |
| Anti-MYBPC3 |
| Clonality: | Polyclonal |
| Concentration: | 0.6 mg/ml |
| Isotype: | IgG |
| NCBI: | 4607 |
| UniProt: | Q14896 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MYBPC3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human heart muscle and prostate tissues using Anti-MYBPC3 antibody. Corresponding MYBPC3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, heart muscle, lymph node and prostate using Anti-MYBPC3 antibody HPA040147 (A) shows similar protein distribution across tissues to independent antibody HPA043898 (B). |
|
|
Immunohistochemical staining of human heart muscle shows high expression. |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
Immunohistochemical staining of human lymph node using Anti-MYBPC3 antibody HPA040147. |
|
|
Immunohistochemical staining of human colon using Anti-MYBPC3 antibody HPA040147. |
|
|
HPA040147-100ul |
|
|
HPA040147-100ul |
|
|
HPA040147-100ul |
Product Guarantee and Expert Support
