Anti-ANKDD1B

Catalog Number: ATA-HPA040227
Article Name: Anti-ANKDD1B
Biozol Catalog Number: ATA-HPA040227
Supplier Catalog Number: HPA040227
Alternative Catalog Number: ATA-HPA040227-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Rabbit Polyclonal ANKDD1B Antibody against Human ankyrin repeat and death domain containing 1B. Validated for Western Blot
Clonality: Polyclonal
Concentration: 0.05
NCBI: 728780
UniProt: A6NHY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequence: ATQSNHVRIVEYLIQDLHLKDLNQPDEKGRKPFLLAAERGHVEMIEKLTFLNLHTSE
WB Image Caption 1