Anti-TALDO1

Catalog Number: ATA-HPA040373
Article Name: Anti-TALDO1
Biozol Catalog Number: ATA-HPA040373
Supplier Catalog Number: HPA040373
Alternative Catalog Number: ATA-HPA040373-100,ATA-HPA040373-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TALDO1
transaldolase 1
Anti-TALDO1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 6888
UniProt: P37837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TALDO1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Western blot analysis using Anti-TALDO1 antibody HPA040373 (A) shows similar pattern to independent antibody HPA048089 (B).
Western blot analysis in human cell line HepG2.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA040373-100ul
HPA040373-100ul
HPA040373-100ul